PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000263391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 180aa    MW: 20149.3 Da    PI: 10.7542
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000263391genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.2e-1871103335
           GATA   3 nCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    nC++t++p+WR+gp g+k+LCn CG++yrk+++
  MDP0000263391  71 NCRVTNSPMWRKGPLGPKSLCNRCGIRYRKMKM 103
                    9*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.5E-1263112IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.6E-1270111No hitNo description
Gene3DG3DSA:3.30.50.101.3E-1270107IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.09E-1070100No hitNo description
PfamPF003204.9E-1571102IPR000679Zinc finger, GATA-type
PROSITE profilePS50114107199IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MASNQFKFNY TNPAVGTTSR AYNVPKPPKP DDYCDIDXTN KTSXTGGSRK RNLTKVRTXK  60
LDENXIXXNF NCRVTNSPMW RKGPLGPKSL CNRCGIRYRK MKMKEEMERE GKRASEFFPL  120
KFGFSGGFLF ATAVSDLMTT TFRSMMTXSA ESSSAKLSAS SASSSAKNSK VLVLKARENF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349428.15e-59PREDICTED: GATA transcription factor 8-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF137781622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20750.11e-10GATA transcription factor 29